SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000453520 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000453520
Domain Number - Region: 17-48
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0445
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453520   Gene: ENSG00000137843   Transcript: ENST00000561230
Sequence length 104
Comment pep:known chromosome:GRCh37:15:40530960:40558152:1 gene:ENSG00000137843 transcript:ENST00000561230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRS
Download sequence
Identical sequences H0YM99
ENSP00000453520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]