SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000453524 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453524
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily RNI-like 2.75e-30
Family 28-residue LRR 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453524   Gene: ENSG00000128872   Transcript: ENST00000561407
Sequence length 110
Comment pep:known chromosome:GRCh37:15:52075019:52102489:1 gene:ENSG00000128872 transcript:ENST00000561407 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVE
MEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR
Download sequence
Identical sequences H0YMA2
ENSP00000453524 ENSP00000453524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]