SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000454344 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000454344
Domain Number 1 Region: 304-530
Classification Level Classification E-value
Superfamily RNI-like 7.26e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.038
Further Details:      
 
Domain Number 2 Region: 61-132
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000136
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454344   Gene: ENSG00000099364   Transcript: ENST00000565690
Sequence length 558
Comment pep:novel chromosome:GRCh37:16:30936971:30959339:1 gene:ENSG00000099364 transcript:ENST00000565690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSSRGPGAGARRRRTRCRRCRACVRTECGDCHFCRDMKKFGGPGRMKQSCLLRQCTAP
VLPHTAVCLLCGEAGKEDTVEGEEEKFGLSLMECTICNEIVHPGCLKMGKAEGVINAEIP
NCWECPRCTQEGRTSKVKGGRERHLKKKPKPPLASAEGPAVPSPSPQREKLERFKRMCQL
LERVPDTSSSSSDSDSDSDSSGTSLSEDEAPGEARNGRRPARGSSGEKENRGGRRAVRPG
SGGPLLSWPLGPAPPPRPPQLERHVVRPPPRSPEPDTLPLAAGSDHPLPRAAWLRVFQHL
GPRELCICMRVCRTWSRWCYDKRLWPRMDLSRRKSLTPPMLSGVVRRQPRALDLSWTGVS
KKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPALRLLDLRWIEDVKDSQLRELLLP
PPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVH
LLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRLDLRSCRQLSPEACARLAAA
GPPGPFRCPEEKLLLKDS
Download sequence
Identical sequences A0A096NHW3 A0A1D5RFZ1 A0A287D9S8 A0A2I2YBH2 A0A2K5W783 A0A2K6A1G2 A0A2K6CLJ6 A0A2K6GEM6 A0A2K6LBR3 A0A2K6NBB1 H2R0A9 H3BME1
ENSP00000454344 ENSP00000454344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]