SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000454647 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000454647
Domain Number 1 Region: 426-493
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000109
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454647   Gene: ENSG00000196628   Transcript: ENST00000570177
Sequence length 537
Comment pep:known chromosome:GRCh37:18:52895215:53069471:-1 gene:ENSG00000196628 transcript:ENST00000570177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSAS
TADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQ
SSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPANGTDSIMANR
GSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQAS
SSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHGIIGPSHNGAM
GGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPP
QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITSNNDD
EDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQA
VAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM
Download sequence
Identical sequences A0A2J8NDW8 A0A2J8UES1 I7GNV1
NP_001230162.1.87134 NP_001230162.1.92137 XP_004087753.1.23891 XP_004087754.1.23891 XP_004087755.1.23891 XP_010374169.1.97406 XP_011731767.1.29376 XP_011731768.1.29376 XP_011804546.1.43180 XP_011804555.1.43180 XP_011804562.1.43180 XP_011827116.1.47321 XP_011827117.1.47321 XP_011827118.1.47321 XP_011924368.1.92194 XP_011924369.1.92194 XP_011924370.1.92194 XP_014977536.1.72884 XP_015295250.1.63531 XP_015295252.1.63531 XP_016789264.1.37143 XP_016789265.1.37143 XP_016789266.1.37143 XP_016881445.1.92137 XP_017705635.1.44346 ENSP00000439827 ENSP00000454647 ENSP00000455179 ENSP00000439827 ENSP00000454647 ENSP00000455179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]