SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455029 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455029
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.32e-45
Family G proteins 0.0000221
Further Details:      
 
Domain Number 2 Region: 189-213
Classification Level Classification E-value
Superfamily SOCS box-like 0.000051
Family SOCS box-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455029   Gene: ENSG00000197562   Transcript: ENST00000566290
Sequence length 213
Comment pep:known chromosome:GRCh37:16:639669:677415:1 gene:ENSG00000197562 transcript:ENST00000566290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLP
Download sequence
Identical sequences A0A2J8J8H5 A0A2J8R1I0 H3BNV8
ENSP00000455029 ENSP00000455029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]