SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455135 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455135
Domain Number 1 Region: 536-603
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455135   Gene: ENSG00000196628   Transcript: ENST00000568673
Sequence length 647
Comment pep:putative chromosome:GRCh37:18:52894905:53253139:-1 gene:ENSG00000196628 transcript:ENST00000568673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRNYGDGTPYDHMTSRD
LGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLSPTKP
GSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSS
KPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLS
YPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDAL
GKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQS
RIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSA
NRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQ
SVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPEQKAE
REKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQ
VRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM
Download sequence
Identical sequences A0A1D5QYH1 A0A2J8UET4
NP_001230156.1.87134 NP_001230156.1.92137 XP_003264308.1.23891 XP_003779029.1.23681 XP_003827286.1.60992 XP_005266796.2.92137 XP_005266800.1.92137 XP_005266801.1.92137 XP_005586673.1.63531 XP_005586674.1.63531 XP_005586675.1.63531 XP_008950869.1.60992 XP_009250670.1.23681 XP_010374155.1.97406 XP_011731747.1.29376 XP_011731748.1.29376 XP_011731749.1.29376 XP_011804518.1.43180 XP_011827111.1.47321 XP_011924328.1.92194 XP_011924339.1.92194 XP_011924340.1.92194 XP_011924341.1.92194 XP_011924342.1.92194 XP_014977524.1.72884 XP_014977525.1.72884 XP_014977526.1.72884 XP_017705626.1.44346 XP_017705627.1.44346 XP_018869489.1.27298 XP_018869490.1.27298 ENSP00000440731 ENSP00000455135 ENSP00000440731 ENSP00000455135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]