SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455217 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455217
Domain Number 1 Region: 3-252
Classification Level Classification E-value
Superfamily RNI-like 1.14e-44
Family Cyclin A/CDK2-associated p19, Skp2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455217   Gene: ENSG00000127585   Transcript: ENST00000562563
Sequence length 267
Comment pep:putative chromosome:GRCh37:16:742927:746025:-1 gene:ENSG00000127585 transcript:ENST00000562563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAE
LSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTALSLSGCSK
VTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSY
LSTMSSLRSLYLRWCCQVQDFGLKHLLALGSLRLLSLAGCPLLTTTGLSGLVQLQELEEL
ELTNCPGATPELFKYFSQHLPRCLVIE
Download sequence
Identical sequences A0A2J8J8C2 A0A2J8R1B2 A0A2K6UWU9 F7FVD6 G1R9Y6
ENSCJAP00000044979 XP_010337277.1.74449 XP_012352778.1.23891 ENSP00000455217 ENSP00000455217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]