SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455261 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455261
Domain Number 1 Region: 485-552
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000126
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455261   Gene: ENSG00000196628   Transcript: ENST00000564228
Sequence length 596
Comment pep:novel chromosome:GRCh37:18:52895142:53070945:-1 gene:ENSG00000196628 transcript:ENST00000564228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDIFFQFIIARVRKCYSLSCLHTLPVVPTLRKTERGSYSSYGRESNLQGCHQSLLGGDM
DMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSAST
ADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQS
SSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPANGTDSIMANRG
SGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQASS
SPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHGIIGPSHNGAMG
GLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQ
DPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITSNNDDE
DLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAV
AVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM
Download sequence
Identical sequences A0A2J8NDW2 A0A2J8UEU7
ENSP00000455261 NP_001293137.1.87134 NP_001293137.1.92137 XP_005586679.1.63531 XP_008950872.1.60992 XP_011731757.1.29376 XP_011804536.1.43180 XP_011827115.1.47321 XP_011924352.1.92194 XP_012361758.1.23891 XP_014977532.1.72884 XP_016789263.1.37143 XP_018869495.1.27298 ENSP00000455261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]