SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455337 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455337
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000961
Family Cyclin A/CDK2-associated p19, Skp2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455337   Gene: ENSG00000099364   Transcript: ENST00000566320
Sequence length 138
Comment pep:putative chromosome:GRCh37:16:30953696:30959333:1 gene:ENSG00000099364 transcript:ENST00000566320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLQELVLSGCSWLSVSALGSAPLPALRLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESR
GRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVHLLTAPTSPLRET
LVHLNLAGFSSFPLTLTP
Download sequence
Identical sequences H3BPI8
ENSP00000455337 ENSP00000455337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]