SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455444 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455444
Domain Number 1 Region: 48-109
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000107
Family HLH, helix-loop-helix DNA-binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455444   Gene: ENSG00000261787   Transcript: ENST00000563496
Sequence length 167
Comment pep:known chromosome:GRCh37:8:67858736:67874825:-1 gene:ENSG00000261787 transcript:ENST00000563496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGRPAGSPLSASAEPAPLAAAIRDSRPGRTGPGPAGPGGGSRSGSGRPAAANAARERS
RVQTLRHAFLELQRTLPSVPPDTKLSKLDVLLLATTYIAHLTRSLQDDAEAPADAGLGAL
RGDGYLHPVKKWPMRSRLYIGATGQFLKHSVSGEKTNHDNTPTDSQP
Download sequence
Identical sequences Q7RTU0
NP_001180431.1.87134 NP_001180431.1.92137 XP_016868429.1.92137 ENSP00000455444 gi|301897298|ref|NP_001180431.1| ENSP00000455444 ENSP00000455444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]