SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455445 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455445
Domain Number 1 Region: 19-213
Classification Level Classification E-value
Superfamily L domain-like 4.15e-40
Family Internalin LRR domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455445   Gene: ENSG00000180979   Transcript: ENST00000563454
Sequence length 239
Comment pep:known chromosome:GRCh37:15:42834722:42840970:-1 gene:ENSG00000180979 transcript:ENST00000563454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGK
FTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL
GALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKI
LRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFA
Download sequence
Identical sequences A0A024R9M3 G3R2C6 H2Q996 Q8N9N7
NP_694992.2.87134 NP_694992.2.92137 XP_003314701.1.37143 XP_004056100.1.27298 XP_008971429.1.60992 XP_008971435.1.60992 ENSGGOP00000009373 9598.ENSPTRP00000011913 9606.ENSP00000326817 ENSPTRP00000011913 ENSP00000326817 ENSP00000380319 ENSP00000455445 ENSGGOP00000009373 ENSP00000326817 ENSP00000326817 ENSP00000380319 ENSP00000455445 ENSPTRP00000011913 gi|194394161|ref|NP_694992.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]