SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455529 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455529
Domain Number 1 Region: 420-646
Classification Level Classification E-value
Superfamily RNI-like 1.1e-29
Family Cyclin A/CDK2-associated p19, Skp2 0.038
Further Details:      
 
Domain Number 2 Region: 61-132
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000387
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455529   Gene: ENSG00000099364   Transcript: ENST00000562319
Sequence length 674
Comment pep:known chromosome:GRCh37:16:30935896:30958770:1 gene:ENSG00000099364 transcript:ENST00000562319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSSRGPGAGARRRRTRCRRCRACVRTECGDCHFCRDMKKFGGPGRMKQSCLLRQCTAP
VLPHTAVCLLCGEAGKEDTVEGEEEKFGLSLMECTICNEIVHPGCLKMGKAEGVINAEIP
NCWECPRCTQEGRTSKDSGEGPGRRRADNGEEGASLGSGWKLTEEPPLPPPPPRRKGPLP
AGPPPEDVPGPPKRKEREAGNEPPTPRKKVKGGRERHLKKVGGDACLLRGSDPGGPGLLP
PRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGPAVPSPSPQREKLERFKRMCQLLERV
PDTSSSSSDSDSDSDSSGTSLSEDEAPGEARNGRRPARGSSGEKENRGGRRAVRPGSGGP
LLSWPLGPAPPPRPPQLERHVVRPPPRSPEPDTLPLAAGSDHPLPRAAWLRVFQHLGPRE
LCICMRVCRTWSRWCYDKRLWPRMDLSRRKSLTPPMLSGVVRRQPRALDLSWTGVSKKQL
MWLLNRLQGLQELVLSGCSWLSVSALGSAPLPALRLLDLRWIEDVKDSQLRELLLPPPDT
KPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVHLLTA
PTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRLDLRSCRQLSPEACARLAAAGPPG
PFRCPEEKLLLKDS
Download sequence
Identical sequences A0A1D5RKU6 A0A2I2YZZ2 A0A2J8J4Y6 A0A2K6CLI6 A0A2K6LBS8 A0A2K6NB67 H3BPZ0 M3VYS7
XP_005591752.1.63531 XP_010360537.1.97406 XP_011288838.1.62641 XP_011741734.1.29376 XP_012388144.1.21590 XP_012587457.1.23501 XP_014650093.1.5094 XP_014981465.1.72884 XP_018868070.1.27298 XP_019291873.1.44245 ENSPANP00000012561 ENSP00000339712 ENSP00000455529 ENSP00000339712 ENSP00000455529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]