SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455632 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455632
Domain Number 1 Region: 26-120
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-40
Family Fibronectin type III 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455632   Gene: ENSG00000077238   Transcript: ENST00000566117
Sequence length 120
Comment pep:known chromosome:GRCh37:16:27324989:27356341:1 gene:ENSG00000077238 transcript:ENST00000566117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRL
LYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEH
Download sequence
Identical sequences J9JII2
ENSP00000455632 ENSP00000456930 ENSP00000455632 ENSP00000456930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]