SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455736 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455736
Domain Number 1 Region: 15-122,218-394
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.12e-108
Family Pyruvate kinase 0.00000000057
Further Details:      
 
Domain Number 2 Region: 400-530
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 7.06e-44
Family Pyruvate kinase, C-terminal domain 0.000000316
Further Details:      
 
Domain Number 3 Region: 117-218
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 9.59e-30
Family Pyruvate kinase beta-barrel domain 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455736   Gene: ENSG00000067225   Transcript: ENST00000565184
Sequence length 531
Comment pep:known chromosome:GRCh37:15:72491373:72523512:-1 gene:ENSG00000067225 transcript:ENST00000565184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEAS
YKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE
AWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
Download sequence
Identical sequences A0A024R5Z9 G3S8Q3 H2Q9R0
ENSP00000320171 ENSP00000455736 ENSP00000455901 ENSP00000456970 ENSP00000373745 ENSP00000320171 ENSP00000373745 ENSP00000455736 ENSP00000455901 ENSP00000456970 ENSPTRP00000012388 ENSGGOP00000004962 gi|33286420|ref|NP_872270.1| gi|33286422|ref|NP_872271.1| NP_872270.1.87134 NP_872270.1.92137 NP_872271.1.87134 NP_872271.1.92137 XP_001175057.2.37143 XP_003818599.1.60992 XP_016782606.1.37143 XP_016782609.1.37143 XP_016877802.1.92137 XP_018865984.1.27298 9606.ENSP00000320171 ENSPTRP00000012389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]