SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455763 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455763
Domain Number 1 Region: 396-463
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000995
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455763   Gene: ENSG00000196628   Transcript: ENST00000570287
Sequence length 507
Comment pep:known chromosome:GRCh37:18:52895142:52989217:-1 gene:ENSG00000196628 transcript:ENST00000570287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYCAYTIPGMGGNSLMYYYNGKAVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDG
HHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPM
STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNS
FSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVL
RNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVA
LRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGD
ENLQDTKSSEDKKLDDDKKDIKSITSNNDDEDLTPEQKAEREKERRMANNARERLRVRDI
NEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEK
VSSEPPPLSLAGPHPGMGDASNHMGQM
Download sequence
Identical sequences A0A2J8NDX0 A0A2J8UEW0
ENSP00000455763 NP_001230164.1.87134 NP_001230164.1.92137 XP_005586682.1.63531 XP_008950875.1.60992 XP_009250672.1.23681 XP_010374186.1.97406 XP_011731770.1.29376 XP_011804574.1.43180 XP_011827120.1.47321 XP_011924372.1.92194 XP_012361760.1.23891 XP_014977538.1.72884 XP_016789269.1.37143 XP_017705637.1.44346 XP_018869493.1.27298 ENSP00000455763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]