SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456330 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456330
Domain Number 1 Region: 55-513
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.6e-89
Family GABA-aminotransferase-like 0.0000000000000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456330   Gene: ENSG00000183044   Transcript: ENST00000567812
Sequence length 515
Comment pep:putative chromosome:GRCh37:16:8807471:8875436:1 gene:ENSG00000183044 transcript:ENST00000567812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWQHAKGVPVPQGVMASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPL
MKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPI
GYSHPALLKLIQQPQNASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGS
CSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCL
ATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKK
TVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWG
LDDPADVMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLL
NNAAHAGKALLTGLLDLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLG
GCGDKSIRFRPTLVFRDHHAHLFLNIFSDILADFK
Download sequence
Identical sequences H3BRN4
ENSP00000456330 ENSP00000456330 ENSP00000455198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]