SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456606 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456606
Domain Number 1 Region: 4-209
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.54e-43
Family Protein kinases, catalytic subunit 0.0000000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456606   Gene: ENSG00000070770   Transcript: ENST00000567730
Sequence length 230
Comment pep:novel chromosome:GRCh37:16:58192021:58220760:-1 gene:ENSG00000070770 transcript:ENST00000567730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNY
DQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Download sequence
Identical sequences A0A2J8MVQ7 A0A2J8VZI6 F7BVK0 H3BSA1
ENSP00000456606 ENSP00000456606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]