SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456807 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456807
Domain Number 1 Region: 131-177
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000302
Family UBA domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456807   Gene: ENSG00000138629   Transcript: ENST00000566365
Sequence length 182
Comment pep:novel chromosome:GRCh37:15:74738318:74744719:-1 gene:ENSG00000138629 transcript:ENST00000566365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPVDKVAAMREFRVLHTALHSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQ
DKDLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMP
GGFLFEGLSDDEDDFHPSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGG
AP
Download sequence
Identical sequences H3BSQ2
ENSP00000456807 ENSP00000456807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]