SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457253 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457253
Domain Number 1 Region: 15-122,218-394
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 8.37e-109
Family Pyruvate kinase 0.00000000057
Further Details:      
 
Domain Number 2 Region: 117-218
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 8.2e-30
Family Pyruvate kinase beta-barrel domain 0.00000145
Further Details:      
 
Domain Number 3 Region: 400-485
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 5.1e-26
Family Pyruvate kinase, C-terminal domain 0.00000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457253   Gene: ENSG00000067225   Transcript: ENST00000561609
Sequence length 485
Comment pep:novel chromosome:GRCh37:15:72492849:72521017:-1 gene:ENSG00000067225 transcript:ENST00000561609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEAS
YKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE
AWAED
Download sequence
Identical sequences A0A2J8KR86 H3BTN5
ENSP00000457253 ENSP00000457253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]