SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457727 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457727
Domain Number 1 Region: 8-174
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000706
Family Rna1p (RanGAP1), N-terminal domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457727   Gene: ENSG00000261539   Transcript: ENST00000569138
Sequence length 180
Comment pep:putative chromosome:GRCh37:HG243_PATCH:145410418:145411971:-1 gene:ENSG00000261539 transcript:ENST00000569138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGVTADALVMLAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAILG
ALLGSCCPQLQVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVA
PGPGFPSLEELCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRAL
Download sequence
Identical sequences ENSP00000457727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]