SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457765 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457765
Domain Number 1 Region: 396-463
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000995
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457765   Gene: ENSG00000196628   Transcript: ENST00000561831
Sequence length 507
Comment pep:known chromosome:GRCh37:18:52895109:52969857:-1 gene:ENSG00000196628 transcript:ENST00000561831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFKQCRCSDTGLCCLDHEGKAEVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDG
HHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPM
STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNS
FSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVL
RNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVA
LRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGD
ENLQDTKSSEDKKLDDDKKDIKSITSNNDDEDLTPEQKAEREKERRMANNARERLRVRDI
NEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEK
VSSEPPPLSLAGPHPGMGDASNHMGQM
Download sequence
Identical sequences A0A2I3MV13 A0A2I3TIR2 A0A2J8UEU6 A0A2K5NQK7 A0A2K5W478 A0A2K5XNF9 A0A2K6DUS7 G3SIU5
ENSP00000457765 ENSP00000457765 NP_001230165.1.87134 NP_001230165.1.92137 XP_004087756.1.23891 XP_009250673.1.23681 XP_011827121.1.47321 XP_016789270.1.37143 ENSMMUP00000041206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]