SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000458033 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458033
Domain Number 1 Region: 128-354
Classification Level Classification E-value
Superfamily RNI-like 2.75e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458033   Gene: ENSG00000099364   Transcript: ENST00000471231
Sequence length 382
Comment pep:putative chromosome:GRCh37:16:30934392:30960097:1 gene:ENSG00000099364 transcript:ENST00000471231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCQLLERVPDTSSSSSDSDSDSDSSGTSLSEDEAPGEARNGRRPARGSSGEKENRGGRRA
VRPGSGGPLLSWPLGPAPPPRPPQLERHVVRPPPRSPEPDTLPLAAGSDHPLPRAAWLRV
FQHLGPRELCICMRVCRTWSRWCYDKRLWPRMDLSRRKSLTPPMLSGVVRRQPRALDLSW
TGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPALRLLDLRWIEDVKDSQLRE
LLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGD
PSVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRLDLRSCRQLSPEACAR
LAAAGPPGPFRCPEEKLLLKDS
Download sequence
Identical sequences A0A2J8J4Y7 A0A2K6GEM0 H3BVB1
ENSP00000458033 ENSP00000458033 NP_001269280.1.87134 NP_001269280.1.92137 XP_006070454.1.26621 XP_006896573.1.29581 XP_007452769.1.90284 XP_008151028.1.99482 XP_011837891.1.47321 XP_012388146.1.21590 XP_019291876.1.44245 XP_019291877.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]