SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000458834 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458834
Domain Number 1 Region: 117-379
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.37e-65
Family Protein kinases, catalytic subunit 0.000000741
Further Details:      
 
Domain Number 2 Region: 392-437
Classification Level Classification E-value
Superfamily SH3-domain 0.00000094
Family SH3-domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSP00000458834
Domain Number - Region: 10-68
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0807
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 
Domain Number - Region: 598-629
Classification Level Classification E-value
Superfamily UBA-like 0.0935
Family UBA domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458834   Gene: ENSG00000174292   Transcript: ENST00000570896
Sequence length 661
Comment pep:known chromosome:GRCh37:17:7283853:7293093:1 gene:ENSG00000174292 transcript:ENST00000570896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPEAGSLWLLKLLRDIQLAQFYWPILEELNVTRPEHFDFVKPEDLDGIGMGRPAQRRLS
EALKRLRSGPKSKNWVYKILGGFAPEHKEPTLPSDSPRHLPEPEGGLKCLIPEGAVCRGE
LLGSGCFGVVHRGLWTLPSGKSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHV
LRLHGLVLGQPLQMVMELAPLGSLHARLTAPAPTPPLLVALLCLFLRQLAGAMAYLGARG
LVHRDLATRNLLLASPRTIKVADFGLVRPLGGARGRYVMGGPRPIPYAWCAPESLRHGAF
SSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEDRARLPRPPLCSRALYSLALRCW
APHPADRPSFSHLEGLLQEAGPSEACCVRDVTEPGALRMETGDPITVIEGSPDSTIWKGQ
NGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPAR
GQRRNMPLERMKGISRSLESVLSLGPRPTGGGSSPPEIRQARAVPQGPPGLPPRPPLSSS
SPQPSQPSRERLPWPKRKPPHNHPMGMPGARKAAALSGGLLSDPELQRKIMEVELSVHGV
THQECQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADCWRILEHYQWDLSAASRYVLAR
P
Download sequence
Identical sequences ENSP00000312309 ENSP00000458834 9606.ENSP00000312309 NP_003976.2.87134 NP_003976.2.92137 XP_011522347.1.92137 gi|150010577|ref|NP_003976.2| ENSP00000458834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]