SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000458838 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000458838
Domain Number - Region: 54-141
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00739
Family Cystathionine synthase-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458838   Gene: ENSG00000108963   Transcript: ENST00000571418
Sequence length 431
Comment pep:novel chromosome:GRCh37:17:1933453:1946318:1 gene:ENSG00000108963 transcript:ENST00000571418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRQVMAALVVSGAAEQGGRDGPGRGRAPRGRVANQIPPEILKNPQLQAAIRVLPSNYNFE
IPKTIWRIQQAQAKKVALQMPEGLLLFACTIVDILERFTEAEVMVMGDVTYGACCVDDFT
ARALGADFLVHYGHSCLIPMDTSAQDFRVLYVFVDIRIDTTHLLDSLRLTFPPATALALA
AAQELKAEYRVSVPQCKPLSPGEILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNVP
AYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESR
LRALGLSFVRLLLSEIFPSKLSLLPEVDVWVQVACPRLSIDWGTAFPKPLLTPYEAAVAL
RDISWQQPYPMDFYAGSSLGPWTVNHGQDRRPHAPGRPARGKVQEGSARPPSAVACEDCS
CRDEKVAPLAP
Download sequence
Identical sequences I3L1H5
ENSP00000458838 ENSP00000458838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]