SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000459507 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459507
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily DNase I-like 0.000000000272
Family DNase I-like 0.00000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459507   Gene: ENSG00000213918   Transcript: ENST00000570664
Sequence length 108
Comment pep:putative chromosome:GRCh37:16:3706712:3708096:1 gene:ENSG00000213918 transcript:ENST00000570664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NREPAIVRFFSRFTEVREFAIVPLHAAPGDAVAEIDALYDVYLDVQEKWGLEDVMLMGDF
NAGCSYVRPSQWSSIRLWTSPTFQWLIPDSADTTATPTHCAYDRLPMA
Download sequence
Identical sequences I3L298
ENSP00000459507 ENSP00000459507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]