SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000459921 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459921
Domain Number 1 Region: 59-164,250-437
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.15e-105
Family Pyruvate kinase 0.000000000841
Further Details:      
 
Domain Number 2 Region: 442-573
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 3.79e-40
Family Pyruvate kinase, C-terminal domain 0.000000303
Further Details:      
 
Domain Number 3 Region: 160-261
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 4.01e-29
Family Pyruvate kinase beta-barrel domain 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459921   Gene: ENSG00000262785   Transcript: ENST00000572740
Sequence length 574
Comment pep:known chromosome:GRCh37:HSCHR1_2_CTG31:155275448:155286629:-1 gene:ENSG00000262785 transcript:ENST00000572740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQ
LPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFS
HGSHEYHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKG
SQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQV
ENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAA
LGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRC
NLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM
QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRS
AQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESG
KLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS
Download sequence
Identical sequences P30613
ENSP00000339933 ENSP00000459921 9606.ENSP00000339933 NP_000289.1.87134 NP_000289.1.92137 gi|10835121|ref|NP_000289.1| ENSP00000339933 ENSP00000459921 ENSP00000339933 ENSP00000459447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]