SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000459944 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459944
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-28
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459944   Gene: ENSG00000184939   Transcript: ENST00000573685
Sequence length 103
Comment pep:known chromosome:GRCh37:16:68573194:68597001:1 gene:ENSG00000184939 transcript:ENST00000573685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRPPTAAPQESVTFKDVSVDFTQEEWYHVDPAQRSLYRDVMLENYSHLVSLGYQVSKP
EVIFKLEQGEEPWISEGEIQRPFYPDWKTRPEVKSSHLQQDVS
Download sequence
Identical sequences H3BVC6
ENSP00000458051 ENSP00000459944 ENSP00000458051 ENSP00000459944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]