SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000460832 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460832
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-56
Family Protein kinases, catalytic subunit 0.0000000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460832   Gene: ENSG00000262841   Transcript: ENST00000571061
Sequence length 149
Comment pep:putative chromosome:GRCh37:HSCHR5_1_CTG1:68530666:68568715:1 gene:ENSG00000262841 transcript:ENST00000571061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKL
ADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFL
PGDSDLDQLTRIFETLGTPTEEQWPDMCS
Download sequence
Identical sequences A0A2J8L113 A0A2J8VTU0 D6REC6
ENSP00000425043 ENSP00000477911 ENSP00000425043 ENSP00000460832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]