SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000460875 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460875
Domain Number 1 Region: 601-1039
Classification Level Classification E-value
Superfamily RNI-like 1.74e-75
Family 28-residue LRR 0.0000195
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily DEATH domain 9.53e-23
Family Pyrin domain, PYD 0.027
Further Details:      
 
Domain Number 3 Region: 203-290,317-376
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000407
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 
Weak hits

Sequence:  ENSP00000460875
Domain Number - Region: 151-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00813
Family Nitrogenase iron protein-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460875   Gene: ENSG00000262811   Transcript: ENST00000574420
Sequence length 1059
Comment pep:novel chromosome:GRCh37:HSCHR19LRC_LRC_S_CTG1:55477364:55512093:1 gene:ENSG00000262811 transcript:ENST00000574420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILT
THCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDV
DEMLERFKTEAQETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQ
VMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAF
YLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIED
ICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEEPIYIRVEGFLEED
RRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCL
TRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDLRLF
LDGDILRQDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLSGVE
RLRNPDLIQAGYYSFGLANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVTDLQ
ELLGCLYESQEEELVKEVMAQFKEISLHLNAVDVVPSSFCVKHCRNLQKMSLQVIKENLP
ENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKDLMGLAINDSFLSASLVRILCEQI
ASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDMFPALCEVLRHPEC
NLRYLGLVSCSATTQQWADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKCFLQ
RLSLENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQTLV
LWNCDITSDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLWLWG
CSIPPFSCEDLCSALSCNQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKIDDF
NDELNKLLEEIEEKNPQLIIDTEKHHPWAERPSSHDFMI
Download sequence
Identical sequences J3KN39
ENSP00000263437 ENSP00000458523 ENSP00000458524 ENSP00000459212 ENSP00000459589 ENSP00000460204 ENSP00000460875 ENSP00000461508 ENSP00000473984 ENSP00000263437 ENSP00000479677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]