SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461172 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461172
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily DEATH domain 8.95e-25
Family Pyrin domain, PYD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461172   Gene: ENSG00000262886   Transcript: ENST00000577118
Sequence length 109
Comment pep:known chromosome:GRCh37:HSCHR19LRC_COX1_CTG1:55397629:55413931:1 gene:ENSG00000262886 transcript:ENST00000577118 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILT
THCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLG
Download sequence
Identical sequences F5H7Q5
ENSP00000442351 ENSP00000483772 ENSP00000442351 ENSP00000458633 ENSP00000458844 ENSP00000459065 ENSP00000460387 ENSP00000460574 ENSP00000461172 ENSP00000461492 ENSP00000474919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]