SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461561 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461561
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily RNI-like 0.0000000196
Family 28-residue LRR 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461561   Gene: ENSG00000262329   Transcript: ENST00000572726
Sequence length 88
Comment pep:known chromosome:GRCh37:HSCHR19LRC_LRC_I_CTG1:55495078:55503312:1 gene:ENSG00000262329 transcript:ENST00000572726 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
GHKTVTYLTLQGNDQDDMFPALCEVLRHPECNLRYLGLVSCSATTQQWADLSLALEVNQS
LTAAVLSIWGHRRAMVMPDLAVWNLSLM
Download sequence
Identical sequences A0A2J8IX54 H0YH35
ENSP00000445846 ENSP00000484848 ENSP00000445846 ENSP00000458466 ENSP00000459310 ENSP00000459411 ENSP00000460419 ENSP00000460478 ENSP00000460806 ENSP00000461561 ENSP00000474652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]