SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461801 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461801
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily Bet v1-like 9.89e-20
Family Phoshatidylinositol transfer protein, PITP 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461801   Gene: ENSG00000174238   Transcript: ENST00000576761
Sequence length 66
Comment pep:putative chromosome:GRCh37:17:1438765:1466062:-1 gene:ENSG00000174238 transcript:ENST00000576761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAK
FKSIKT
Download sequence
Identical sequences A0A2J8JKN2 I3NI10
ENSP00000461801 ENSP00000461801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]