SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461914 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000461914
Domain Number - Region: 26-82
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0209
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461914   Gene: ENSG00000010244   Transcript: ENST00000580759
Sequence length 93
Comment pep:putative chromosome:GRCh37:17:30677184:30687750:1 gene:ENSG00000010244 transcript:ENST00000580759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSD
EYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGL
Download sequence
Identical sequences A0A2J8TNC7 J3KRB6
ENSP00000461914 ENSP00000461914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]