SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462123 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462123
Domain Number 1 Region: 6-105
Classification Level Classification E-value
Superfamily HAD-like 3.75e-23
Family 5'(3')-deoxyribonucleotidase (dNT-2) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462123   Gene: ENSG00000125458   Transcript: ENST00000580758
Sequence length 117
Comment pep:known chromosome:GRCh37:17:73126323:73127838:-1 gene:ENSG00000125458 transcript:ENST00000580758 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADK
VASVYEAPGFFLDLEPIPGALDAVREMNDLPDPLLKYHHCVGEKVWLPRPYSARGAA
Download sequence
Identical sequences HR2175 ENSP00000462123 ENSP00000462123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]