SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462193 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000462193
Domain Number - Region: 26-82
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0196
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462193   Gene: ENSG00000010244   Transcript: ENST00000582165
Sequence length 95
Comment pep:putative chromosome:GRCh37:17:30677205:30687758:1 gene:ENSG00000010244 transcript:ENST00000582165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSD
EYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPP
Download sequence
Identical sequences J3KRW6
ENSP00000462193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]