SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462314 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462314
Domain Number 1 Region: 13-374
Classification Level Classification E-value
Superfamily RNI-like 1.41e-58
Family 28-residue LRR 0.019
Further Details:      
 
Domain Number 2 Region: 488-628
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 8.18e-37
Family Gelsolin-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462314   Gene: ENSG00000177731   Transcript: ENST00000578558
Sequence length 700
Comment pep:novel chromosome:GRCh37:17:18148150:18162040:-1 gene:ENSG00000177731 transcript:ENST00000578558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEH
LSVSHNNLTTLHGELSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECP
RELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLV
LNGNPLLHAQLRQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPE
CLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLN
SNKLDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCRCPKLRKLVLNKNHLVTLPEAIH
FLTEIEVLDVRENPNLVMPPKPADRAAEWYNIDFSLQNQLRLAGASPATVAAAAAGSGPK
DPMARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLE
KPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSL
NWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYI
EGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRNMSGRAGCAWSARAMS
STPLPAASTPGAPSARPWPKTGWHSPRLGEEEEGASSTVC
Download sequence
Identical sequences J3KS54
ENSP00000462314 ENSP00000462314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]