SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462443 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462443
Domain Number 1 Region: 6-58
Classification Level Classification E-value
Superfamily RNI-like 0.00000104
Family 28-residue LRR 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462443   Gene: ENSG00000167207   Transcript: ENST00000529633
Sequence length 60
Comment pep:known chromosome:GRCh37:16:50746105:50757285:1 gene:ENSG00000167207 transcript:ENST00000529633 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XLNVGHLKLTFCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKAL
Download sequence
Identical sequences J3QL80
ENSP00000462443 ENSP00000463145 ENSP00000463423 ENSP00000464065 ENSP00000462443 ENSP00000463145 ENSP00000463423 ENSP00000464065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]