SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462491 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462491
Domain Number 1 Region: 4-60
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSP00000462491
Domain Number - Region: 85-123
Classification Level Classification E-value
Superfamily Orange domain-like 0.051
Family Hairy Orange domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462491   Gene: ENSG00000179111   Transcript: ENST00000577735
Sequence length 145
Comment pep:putative chromosome:GRCh37:17:8025122:8027410:-1 gene:ENSG00000179111 transcript:ENST00000577735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSGEMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRE
RSRVEPPAAAAPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFSALH
GYLRPKPPRPKPVDPRPPAPRPSLD
Download sequence
Identical sequences A0A2J8RW86 J3KSH6
ENSP00000462491 ENSP00000462491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]