SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462819 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462819
Domain Number 1 Region: 48-156
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.54e-25
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462819   Gene: ENSG00000166484   Transcript: ENST00000579284
Sequence length 157
Comment pep:known chromosome:GRCh37:17:19281573:19283993:1 gene:ENSG00000166484 transcript:ENST00000579284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLE
Download sequence
Identical sequences A0A2J8J741 A0A2J8RC93 J3KT61
ENSP00000462819 ENSP00000462819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]