SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463132 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463132
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily RNI-like 3.53e-22
Family Cyclin A/CDK2-associated p19, Skp2 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463132   Gene: ENSG00000108306   Transcript: ENST00000581781
Sequence length 115
Comment pep:putative chromosome:GRCh37:17:37420129:37427063:-1 gene:ENSG00000108306 transcript:ENST00000581781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGAC
AHDQLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRVKMAT
Download sequence
Identical sequences A0A2J8KH74 A0A2J8W9T8 J3QKL3
ENSP00000463132 ENSP00000463132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]