SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463368 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463368
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.23e-26
Family Protein kinases, catalytic subunit 0.000000837
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463368   Gene: ENSG00000105221   Transcript: ENST00000476247
Sequence length 106
Comment pep:putative chromosome:GRCh37:19:40739688:40741978:-1 gene:ENSG00000105221 transcript:ENST00000476247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQ
RLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTR
Download sequence
Identical sequences A0A2J8QFT0 A0A2J8SDU4 J3QL45
ENSP00000463368 ENSP00000463368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]