SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000464877 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000464877
Domain Number - Region: 130-291
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0212
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464877   Gene: ENSG00000105088   Transcript: ENST00000590841
Sequence length 376
Comment pep:putative chromosome:GRCh37:19:9964421:9968844:-1 gene:ENSG00000105088 transcript:ENST00000590841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLELRTYRDLQYVRGMETLMRSLDARLRAADGSLSAKSFQELKDRMTELLPLSSVLEQ
YKADTRTIVRLREEVRNLSGSLAAIQEEMGAYGYEDLQQRVMALEARLHACAQKLGCGKL
TGVSNPITVRAMGSRFGSWMTDTMAPSADSRVWYMDGYYKGRRVLEFRTLGDFIKGQNFI
QHLLPQPWAGTGHVVYNGSLFYNKYQSNVVVKYHFRSRSVLVQRSLPGAGYNNTFPYSWG
GFSDMDFMVDESGLWAVYTTNQNAGNIVVSRLDPHTLEVMRSWDTGYPKRSAGEAFMICG
VLYVTNSHLAGAKVYFAYFTNTSSYEYTDVPFHNQYSHISMLDYNPRERALYTWNNGHQV
LYNVTLFHVISTSGDP
Download sequence
Identical sequences A0A0D9R5L3 A0A2J8LWS3 G1RMX8 K7EIS8
NP_001291277.1.87134 NP_001291277.1.92137 XP_007993387.1.81039 XP_012365080.1.23891 ENSP00000464877 ENSP00000464877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]