SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465108 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465108
Domain Number 1 Region: 237-284
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Domain Number 2 Region: 3-111
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000225
Family FCH domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465108   Gene: ENSG00000089639   Transcript: ENST00000593186
Sequence length 303
Comment pep:novel chromosome:GRCh37:19:19745904:19748996:-1 gene:ENSG00000089639 transcript:ENST00000593186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRSREEAQAKAQEAEALYQACVREANARQQDLEIAKQRIVSHVRKLVFQGDEVLRRVTLS
LFGLRGAQAERGPRAFAALAECCAPFEPGQRYQEFVRALRPEAPPPPPPAFSFQEFLPSL
NSSPLDIRKKLSGPLPPRLDENSAEPGPWEDPGTGWRWQGPTPGSDVDSVGGGSESRSLD
SPTSSPGAGTRQLVKASSTGTESSDDFEERDPDLGDGLENGLGSPFGKWTLSSAAQTHQL
RRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILCGHRRLPARTPLFGVDFLQL
PRD
Download sequence
Identical sequences K7EJC2
ENSP00000465108 ENSP00000465108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]