SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465172 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465172
Domain Number 1 Region: 68-114
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-21
Family KRAB domain (Kruppel-associated box) 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465172   Gene: ENSG00000267179   Transcript: ENST00000591944
Sequence length 115
Comment pep:putative chromosome:GRCh37:19:12035926:12089060:1 gene:ENSG00000267179 transcript:ENST00000591944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCCSHRSCREDPGTSESREMRPESSDCKLKPVRNLQREVIESSHQAQWLTPVIPALWEA
KADGASQMFQDPVACEDVAVNFTQEEWALLDISQRKLYREVMLETFRNLTSIGVS
Download sequence
Identical sequences K7EJH5
ENSP00000465172 ENSP00000465172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]