SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465227 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000465227
Domain Number - Region: 127-235
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00353
Family Comoviridae-like VP 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465227   Gene: ENSG00000108840   Transcript: ENST00000588261
Sequence length 282
Comment pep:novel chromosome:GRCh37:17:42165816:42170555:-1 gene:ENSG00000108840 transcript:ENST00000588261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKLP
LPGPYDSRDDFPLRKTASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHR
ALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQG
GTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSP
LVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLV
Download sequence
Identical sequences K7EJL4
ENSP00000465227 ENSP00000465227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]