SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465248 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465248
Domain Number 1 Region: 13-43
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000016
Family HLH, helix-loop-helix DNA-binding domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465248   Gene: ENSG00000069812   Transcript: ENST00000487437
Sequence length 77
Comment pep:putative chromosome:GRCh37:1:6478474:6479967:-1 gene:ENSG00000069812 transcript:ENST00000487437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRECLATATARATAPV
WRAWPACCPPAVSWSPP
Download sequence
Identical sequences A0A2I3RQD2 G3QHJ0 K7EJN2
ENSP00000465248 ENSP00000465248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]