SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465270 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465270
Domain Number 1 Region: 8-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000393
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465270   Gene: ENSG00000069812   Transcript: ENST00000489730
Sequence length 82
Comment pep:putative chromosome:GRCh37:1:6478909:6479977:-1 gene:ENSG00000069812 transcript:ENST00000489730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVL
EMTVRFLQELPASSWPTAAPRE
Download sequence
Identical sequences A0A2J8KY56 A0A2J8URW3 K7EJQ0
ENSP00000465270 ENSP00000465270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]