SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465401 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465401
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465401   Gene: ENSG00000167380   Transcript: ENST00000588883
Sequence length 89
Comment pep:putative chromosome:GRCh37:19:44669254:44682534:1 gene:ENSG00000167380 transcript:ENST00000588883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMFKEAVTFKDVAVAFTEEELGLLGPAQRKLYRDVMVENFRNLLSVGHPPFKQDVSPIE
RNEQLWIMTTATRRQGNLGKNQTVMSSYS
Download sequence
Identical sequences K7EK05
ENSP00000464735 ENSP00000465401 ENSP00000467748 ENSP00000464735 ENSP00000465401 ENSP00000467748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]