SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465402 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465402
Domain Number 1 Region: 9-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000893
Family Biotin repressor-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465402   Gene: ENSG00000179115   Transcript: ENST00000587981
Sequence length 168
Comment pep:putative chromosome:GRCh37:19:13041121:13044525:-1 gene:ENSG00000179115 transcript:ENST00000587981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGQVAELLLRRLEASDGGLDSAELAAELGMEHQAVVGAVKSLQALGEVIEAELRSTKH
WELTAEGEEIAREGSHEARVFRSIPPEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKSAA
DGPRVFRVVRSCGLVRGQVDGHMGPWPSYPSHSLSWQVDSMEDEVQRR
Download sequence
Identical sequences K7EK06
ENSP00000465402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]