SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465745 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000465745
Domain Number - Region: 9-40
Classification Level Classification E-value
Superfamily UBA-like 0.00316
Family TAP-C domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465745   Gene: ENSG00000153443   Transcript: ENST00000587649
Sequence length 122
Comment pep:putative chromosome:GRCh37:16:4659722:4664874:-1 gene:ENSG00000153443 transcript:ENST00000587649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFEVRGAGAGRGPGPRAECVPRG
RRAGADGVDACRLCAPSGPQTRPAFPTAVPGVRIPRARGGRRQPSAPFSRRPTSPTATIT
TR
Download sequence
Identical sequences K7EKR5
ENSP00000465745 ENSP00000465745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]